Pancreatic Polypeptide

Overview

Pancreatic polypeptide (PP) is a 36-amino acid peptide hormone isolated independently by several groups in the early 1970s — most notably by Kimmel and colleagues from avian pancreas (as "aPP" or avian PP) and by Chance and colleagues from mammalian pancreas. It is the founding member of the "PP-fold" peptide family that also includes peptide YY (PYY) and neuropeptide Y (NPY).

PP is secreted by a specialized cell type of the pancreatic islets: the PP cells (sometimes called F cells or γ cells), which are distinct from α (glucagon), β (insulin), δ (somatostatin), and ε (ghrelin) islet cells. PP cells are concentrated in the uncinate process and posterior portion of the pancreatic head, reflecting the developmental origin of that region from the ventral pancreatic bud.

Plasma PP rises sharply after food intake, with a biphasic response: an early cephalic phase driven by vagal cholinergic input before nutrient absorption, followed by a sustained phase driven by intestinal signals and direct nutrient contact with the pancreas. The magnitude of the postprandial PP rise is proportional to caloric intake, particularly protein, and is blunted by vagotomy — demonstrating PP's role as a marker of vagal activity and a readout of integrated cephalic-gut-pancreatic signaling.

PP acts principally through the Y4 receptor — a member of the Y-family GPCRs for which PP is the preferred endogenous ligand. Y4 has a distinct expression pattern from Y1, Y2, and Y5, concentrated in areas related to food intake, gastrointestinal function, and autonomic regulation. PP's physiological effects include inhibition of pancreatic exocrine secretion, gallbladder contraction modulation, delayed gastric emptying, and a modest but reproducible appetite-suppressing effect.

Structure/Sequence

Human Pancreatic Polypeptide: APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH₂

• Length: 36 amino acids
• Molecular weight: ~4,181 g/mol
• Gene: PPY (chromosome 17q21.31)
• C-terminal amidation: Essential for Y4 receptor binding
• C-terminal -TRPRY-NH₂: The key pharmacophore for Y-receptor activation
• N-terminal Ala: Distinctive feature versus PYY (N-terminal Tyr)

PP-Fold Tertiary Structure

PP adopts the characteristic PP-fold:

• Polyproline II helix (residues 1-8)
• Hairpin turn
• Amphipathic α-helix (residues 15-32)
• Hydrophobic core between the two helical elements
• Compact structure stabilized without disulfide bonds

This fold is shared with PYY and NPY and is the structural basis of high-affinity Y-receptor binding.

Species Variation

PP shows more species-to-species sequence variation than PYY or NPY. Avian PP (aPP) differs substantially from mammalian PP and has historically been used in research because of distinctive pharmacology at mammalian Y4. Human PP has evolved rapidly and differs notably from mouse PP.

Mechanism of Action

Y4 Receptor

PP signals primarily through the Y4 receptor (PPYR1):

• G-protein coupling: Gi/o — inhibits adenylyl cyclase
• PP affinity: Low nanomolar (PP is the highest-affinity ligand at Y4)
• Expression: Gastrointestinal tract, pancreas, area postrema, vagal sensory neurons, cortex, hippocampus, hypothalamus
• Selectivity: PP >> PYY > NPY at Y4

Pancreatic Effects

• Inhibits pancreatic exocrine (acinar) secretion of enzymes
• Opposes cholecystokinin-induced pancreatic enzyme release
• May modulate islet cell function through local paracrine effects
• Reduces pancreatic blood flow

Gastrointestinal Effects

• Delays gastric emptying
• Reduces gallbladder motility
• Modulates intestinal motility
• Reduces pancreatic and biliary secretion — part of enteropancreatic feedback

Appetite and Feeding

• Peripheral PP administration modestly reduces food intake
• Effects mediated through vagal afferent Y4 receptors and area postrema
• Magnitude less dramatic than PYY 3-36 or GLP-1
• Effects on food preference (reduced high-fat preference in some studies)

Vagal Biomarker

• Postprandial PP rise requires vagal cholinergic input
• Atropine blocks PP response
• Loss of PP response after vagotomy
• Used as research marker of vagal function in human studies

Autonomic and CNS Effects

• PP-expressing cells in the cortex (the "PP-like" interneurons in some regions)
• Role in corticohypothalamic circuits
• Modulates autonomic outflow

Research Summary

Common Discussion Topics

1. PP cell as distinct islet cell type — PP cells constitute one of the five major endocrine cell types in the pancreatic islet, alongside α (glucagon), β (insulin), δ (somatostatin), and ε (ghrelin). PP cells are non-uniformly distributed, concentrated in the uncinate process, reflecting developmental origin from ventral pancreatic bud.

2. Vagal biomarker — The dependence of postprandial PP release on vagal cholinergic input has made PP a useful clinical research tool for assessing vagal function, particularly in studies of autonomic neuropathy, vagotomy effects, and bariatric surgery.

3. PP-fold structural paradigm — PP's crystal structure (1981) provided the template for understanding the entire PP-fold family. The unique architecture of polyproline II helix packed against C-terminal α-helix has become a canonical example in peptide structural biology.

4. Y4 receptor specialization — Y4 is one of the more specialized Y-family receptors, with PP as its preferred ligand and distinct physiological roles from Y1, Y2, and Y5. Y4 agonists have been explored as modest appetite suppressants and regulators of GI motility.

5. Comparison to PYY — PYY and PP share the PP-fold and similar tissue distributions but have distinct receptor preferences (Y2 vs Y4) and distinct physiological emphases (PYY: satiety and ileal brake; PP: pancreatic exocrine regulation and mild satiety). Their co-evolution illustrates functional divergence of paralogous peptides.

Related Compounds

• Peptide YY — closely related PP-fold family member
• Neuropeptide Y — CNS-dominant PP-fold family member
• Insulin — co-regional islet hormone
• Glucagon — co-regional islet hormone