Neuromedin B

Overview

Neuromedin B (NMB) is a 10-amino acid neuropeptide isolated in 1983 by Minamino and colleagues from porcine spinal cord, belonging to the broader family of "neuromedins" — a group of peptides originally identified through systematic screening of spinal cord extracts for smooth muscle-active substances. NMB is the mammalian homolog of the amphibian skin peptide ranatensin (first isolated from Rana pipiens) and is the principal mammalian member of the bombesin-like peptide family, alongside gastrin-releasing peptide (GRP).

The bombesin family comprises three distinct subfamilies: the bombesin/GRP subfamily, the ranatensin/NMB subfamily, and the phyllolitorin subfamily. In mammals, only the first two are represented, with NMB and GRP serving as the two endogenous bombesin-like peptides. A third mammalian bombesin-related receptor — BRS-3 (bombesin receptor subtype 3) — remained orphan for many years until the recent identification of candidate endogenous ligands; it is activated only weakly by NMB and GRP.

NMB signals primarily through the NMB receptor (NMBR, BB1), a GPCR with distinct pharmacology from the GRP receptor (GRPR, BB2). NMB is expressed in central nervous system structures (hypothalamus, brainstem, olfactory bulb, spinal cord), gastrointestinal tract, and thyroid — the latter placing NMB in the intrathyroidal feedback network alongside TRH-TSH-thyroid hormone signaling. Its physiological roles span smooth muscle contraction (the original "neuromedin" activity), thermoregulation, satiety and feeding, thyroid hormone secretion, and fear/anxiety behaviors.

Structure/Sequence

Human NMB (Neuromedin B-10): GNLWATGHFM-NH₂

• Length: 10 amino acids (decapeptide)
• Molecular weight: ~1,132 g/mol
• Gene: NMB (chromosome 15q24-q25)
• C-terminal amidation: Essential for bioactivity
• C-terminal methionine-NH₂: Conserved across bombesin family; key for receptor binding
• N-terminal processing: Mature form excised from 76-aa precursor

Bombesin Family Homology

• NMB: GNLWATGHFM-NH₂ (human decapeptide)
• Neuromedin C: GNHWAVGHLM-NH₂ (10-aa, a C-terminal fragment of GRP)
• GRP: APVSVGGGTVLAKMYPRGNHWAVGHLM-NH₂ (27 aa, with NMC as C-terminal portion)
• Bombesin (frog): pGlu-QRLGNQWAVGHLM-NH₂ (14 aa)
• Ranatensin (frog): pGlu-VPQWAVGHFM-NH₂ (11 aa, NMB analog)

The conserved C-terminal -WAVGHLM-NH₂ or -WATGHFM-NH₂ motif defines the bombesin/ranatensin family pharmacophore.

Larger Form

Neuromedin B-32 is a larger N-terminally extended form that also exists in tissues. The decapeptide NMB-10 is the minimum active form.

Mechanism of Action

Neuromedin B Receptor (NMBR, BB1)

NMB signals primarily through NMBR:

• G-protein coupling: Gq/11
• Activates phospholipase C → IP3/DAG → Ca²⁺ mobilization and PKC activation
• Activates MAPK pathways
• Selectivity: NMB >> NMC/GRP > bombesin; NMBR has lower affinity for GRP than for NMB

GRP Receptor (GRPR, BB2)

NMB has lower but measurable affinity for GRPR, and GRP has lower affinity for NMBR. Substantial cross-reactivity complicates interpretation of effects attributed solely to one receptor without selective antagonists.

BRS-3 (Bombesin Receptor Subtype 3)

• Weakly activated by NMB or GRP
• Long considered orphan; candidate endogenous ligands proposed
• Broad interest in BRS-3 as metabolic target

Smooth Muscle Contraction

• Contracts uterine smooth muscle (original NMB bioassay)
• Contracts gastrointestinal smooth muscle
• Effects mediated through NMBR on smooth muscle cells

CNS Effects

• Thermoregulation: Central NMB decreases body temperature through preoptic area
• Feeding: NMB reduces food intake centrally
• Fear and anxiety: NMBR expressed in amygdala; role in fear memory
• Olfactory processing: Dense NMBR expression in olfactory bulb

Thyroid Function

• NMB expressed in thyroid C cells
• Modulates TSH-stimulated thyroid hormone release
• Part of intra-thyroidal paracrine network

Lung and Exocrine Pancreas

• Stimulates amylase release from pancreatic acinar cells
• Effects on bronchial smooth muscle

Research Summary

Common Discussion Topics

1. Bombesin family architecture — NMB, GRP (and its C-terminal fragment NMC), and amphibian bombesin/ranatensin constitute a peptide family with conserved C-terminal pharmacophores and three GPCR receptors (NMBR, GRPR, BRS-3). Studying cross-selectivity and subtype-specific effects has been informative about GPCR ligand selectivity principles.

2. Amphibian skin origins — Like many mammalian peptide systems, bombesin-family biology was accelerated by amphibian skin peptides: bombesin from Bombina bombina, ranatensin from Rana, and phyllolitorin from Phyllomedusa. Amphibian skin has been a remarkable source of bioactive peptide lead compounds (see also dermorphin).

3. BRS-3 orphan pharmacology — BRS-3 has attracted interest as a metabolic drug target because BRS-3 knockout mice are obese and hypertensive. Identifying its endogenous ligand(s) and developing selective agonists has been an active area, with various candidate endogenous peptides proposed.

4. Smooth muscle contraction as founding assay — NMB was originally identified through its smooth muscle-contracting activity, reflecting the common bioassay approach of that era. Many peptides (e.g., substance P, bradykinin) were similarly identified. The functional breadth of these peptides extends well beyond smooth muscle, but the original assays determined their names.

5. CNS and fear circuits — NMBR expression in amygdala and studies in NMBR knockout mice have revealed roles in fear memory and anxiety. This places NMB alongside other neuropeptides (oxytocin, NPY, orexin) that modulate fear and anxiety circuits.

Related Compounds

• Neuromedin U — structurally unrelated but co-discovered neuromedin
• Neurotensin — unrelated gut-brain peptide with overlapping themes
• Substance P — related pro-contractile sensory neuropeptide