Nesfatin-1

Overview

Nesfatin-1 is an 82-amino acid peptide derived from nucleobindin-2 (NUCB2), a widely expressed cellular protein with EF-hand calcium-binding domains. It was identified in 2006 by Shimizu, Mori, and colleagues at Gunma University through subtractive cloning aimed at finding novel hypothalamic peptides with leptin-like actions. The name "nesfatin" is a contraction of "NEFA/nucleobindin 2-encoded satiety and fat-influencing protein."

The key initial observation was that intracerebroventricular administration of nesfatin-1 potently suppressed food intake in rodents, with an effect comparable in magnitude to leptin but operating through a leptin-independent mechanism. Nesfatin-1 reduced food intake in leptin receptor-deficient db/db mice and in mice with induced leptin resistance, establishing it as a parallel rather than downstream satiety signal.

Nesfatin-1 is released by cleavage of the N-terminal 82 residues from the larger NUCB2 precursor. Smaller fragments — nesfatin-2 (residues 85-163) and nesfatin-3 (residues 166-396) — can also be generated, though their bioactivity is less well established. Nesfatin-1 is expressed in hypothalamic nuclei (paraventricular, arcuate, supraoptic, lateral hypothalamus) as well as in many peripheral tissues including stomach, pancreas, adipose tissue, and heart, making it both a central neuropeptide and a peripheral peptide hormone.

Beyond feeding behavior, nesfatin-1 has been implicated in stress and anxiety responses (via HPA axis activation), glucose homeostasis (insulinotropic actions), reproductive regulation, cardiovascular function, and gastrointestinal motility. A specific nesfatin-1 receptor has not yet been definitively cloned despite extensive searching, representing one of the field's persistent puzzles.

Structure/Sequence

Nesfatin-1: Corresponds to residues 1-82 of preproNUCB2 (after signal peptide cleavage)

Mid-segment (residues 24-53) of Nesfatin-1: VPIDIDKTKVHNTEPVEMNPFLSKIEIGKEFQ (the "M30" active core reported by several groups)

• Length: 82 amino acids
• Molecular weight: ~9.7 kDa
• Gene: NUCB2 (chromosome 11p15.1)
• Precursor: Preproprotein of 396 amino acids, including signal peptide and generating nesfatin-1, -2, -3
• Post-translational modifications: N-linked glycosylation sites in NUCB2

Active Core

Multiple studies have reported that the mid-segment of nesfatin-1 — sometimes designated nesfatin-1(24-53) or "M30" — retains anorexigenic activity. This suggests that the full-length peptide may contain auxiliary regions not strictly required for food intake suppression.

Species Conservation

Nesfatin-1 is highly conserved across vertebrates, with active orthologs described in fish, birds, and mammals.

Mechanism of Action

Central Feeding Suppression

• ICV or fourth-ventricle nesfatin-1 reduces food intake acutely and with chronic administration
• Effects operate in leptin-deficient and leptin-resistant animals
• Active nesfatin-1 neurons are in the paraventricular nucleus and supraoptic nucleus
• Downstream circuits involve melanocortin signaling (blocked by SHU9119, an MC3/4R antagonist)
• CRH neurons activated by central nesfatin-1

Unidentified Receptor

Despite considerable effort, a specific nesfatin-1 receptor has not been definitively cloned. Proposed candidates have included:

• A G-protein coupled receptor (evidence of pertussis toxin-sensitive signaling)
• Involvement of calcium channels in nesfatin-1 responses
• Possible direct membrane interactions

This receptor-orphan status is a persistent limitation of the field.

Peripheral Effects

• Pancreatic β-cells: Stimulates glucose-induced insulin secretion
• Adipose tissue: NUCB2/nesfatin-1 expressed; modulates lipolysis
• Stomach: Gastric X/A-like cells express nesfatin-1 alongside ghrelin, with reciprocal regulation
• Cardiovascular: Cardioprotective effects in ischemia-reperfusion models

HPA Axis Activation

• Stimulates CRH release
• Increases ACTH and corticosterone
• Mediates some stress-related effects
• Anxiogenic in some behavioral models

Glucose Homeostasis

• Improves glucose tolerance in animal models
• Stimulates insulin secretion
• Reduces hepatic glucose production
• Effects complementary to leptin and insulin in metabolic regulation

Reproduction

• Modulates LH release
• Expressed in reproductive tissues
• Effects on puberty onset in rodent models

Research Summary

Common Discussion Topics

1. Leptin-independent satiety — Nesfatin-1's efficacy in leptin-resistant animals is its most clinically intriguing feature. It suggests that satiety can be restored through pathways bypassing the leptin circuit, which is informative for understanding and potentially addressing obesity.

2. Orphan receptor puzzle — Despite over a decade since discovery, no nesfatin-1 receptor has been definitively identified. This puts nesfatin-1 in a small group of bioactive peptides whose mechanism of action is inferred from functional experiments rather than molecular receptor pharmacology. This gap limits precise pharmacological manipulation.

3. NUCB2 as cryptic prohormone — NUCB2 was studied for years as a calcium-binding protein before its peptide-precursor role was recognized. This continues the theme that "known" proteins can harbor cryptic peptide modules (cf. tuftsin, lactoferricin).

4. Dual central-peripheral role — Like leptin and ghrelin, nesfatin-1 operates as both a brain peptide and a circulating peripheral hormone, integrating central and peripheral metabolic signals.

5. Stress-feeding interaction — Nesfatin-1 activates both feeding-suppression circuits and stress circuits. This connection may explain stress-induced anorexia and links nesfatin-1 to the broader integration of feeding, mood, and stress.

Related Compounds

• Leptin — primary satiety hormone with overlapping but distinct pathway
• Orexin-A — opposing orexigenic/arousal peptide
• Neuropeptide Y — major orexigenic counterweight
• Phoenixin — related small-ORF-encoded novel peptide
• Spexin — related bioinformatics-era discovered metabolic peptide